Chemical materials

GSK2983559

GSK2983559

AL-G658853 / 50MG
Add to Inquiry
GSK2983559

GSK2983559

AL-G658853 / 25MG
Add to Inquiry
GSK3 Substrate, α, β subunit
Add to Inquiry
GSK3 Substrate, α, β subunit
Add to Inquiry
GSK3 Substrate, α, β subunit

GSK3 Substrate, α, β subunit

AL-G658862 / 10MG
Add to Inquiry
GIP, human TFA

GIP, human TFA

AL-G658910 / 1MG
Add to Inquiry
GIP, human TFA

GIP, human TFA

AL-G658910 / 5MG
Add to Inquiry
GLS-1-IN-1

GLS-1-IN-1

AL-G658912 / 10MG
Add to Inquiry
GLS-1-IN-1

GLS-1-IN-1

AL-G658912 / 5MG
Add to Inquiry
Gemcitabine elaidate hydrochloride

Gemcitabine elaidate hydrochloride

AL-G658918 / 100MG
CAS No.:2918768-08-6
Add to Inquiry
Gemcitabine elaidate hydrochloride

Gemcitabine elaidate hydrochloride

AL-G658918 / 50MG
CAS No.:2918768-08-6
Add to Inquiry
Gemcitabine elaidate hydrochloride

Gemcitabine elaidate hydrochloride

AL-G658918 / 25MG
CAS No.:2918768-08-6
Add to Inquiry
Gemcitabine elaidate hydrochloride

Gemcitabine elaidate hydrochloride

AL-G658918 / 10MG
CAS No.:2918768-08-6
Add to Inquiry
Gemcitabine elaidate hydrochloride

Gemcitabine elaidate hydrochloride

AL-G658918 / 5MG
CAS No.:2918768-08-6
Add to Inquiry
Galanin (1-16), mouse, porcine, rat TFA
Add to Inquiry
Galanin (1-16), mouse, porcine, rat TFA
Add to Inquiry
Galanin (1-16), mouse, porcine, rat TFA
Add to Inquiry
Glepaglutide acetate

Glepaglutide acetate

AL-G658965 / 10MG
Add to Inquiry
Glepaglutide acetate

Glepaglutide acetate

AL-G658965 / 5MG
Add to Inquiry
Glepaglutide acetate

Glepaglutide acetate

AL-G658965 / 1MG
Add to Inquiry
GPLGIAGQ TFA

GPLGIAGQ TFA

AL-G658993 / 25MG
CAS No.:109053-09-0
Add to Inquiry
GPLGIAGQ TFA

GPLGIAGQ TFA

AL-G658993 / 10MG
CAS No.:109053-09-0
Add to Inquiry
GPLGIAGQ TFA

GPLGIAGQ TFA

AL-G658993 / 5MG
CAS No.:109053-09-0
Add to Inquiry
GPLGIAGQ TFA

GPLGIAGQ TFA

AL-G658993 / 50MG
CAS No.:109053-09-0
Add to Inquiry
GSK2945 hydrochloride

GSK2945 hydrochloride

AL-G659004 / 5MG
Add to Inquiry
GSK2945 hydrochloride

GSK2945 hydrochloride

AL-G659004 / 10MG
Add to Inquiry
GSK2945 hydrochloride

GSK2945 hydrochloride

AL-G659004 / 50MG
Add to Inquiry
GSK2945 hydrochloride

GSK2945 hydrochloride

AL-G659004 / 100MG
Add to Inquiry
GSK 690 Hydrochloride

GSK 690 Hydrochloride

AL-G659015 / 50MG
CAS No.:2436760-79-9
Add to Inquiry
GSK 690 Hydrochloride

GSK 690 Hydrochloride

AL-G659015 / 5MG
CAS No.:2436760-79-9
Add to Inquiry
GSK 690 Hydrochloride

GSK 690 Hydrochloride

AL-G659015 / 10MG
CAS No.:2436760-79-9
Add to Inquiry
GSK 690 Hydrochloride

GSK 690 Hydrochloride

AL-G659015 / 25MG
CAS No.:2436760-79-9
Add to Inquiry
GPR84 antagonist 1

GPR84 antagonist 1

AL-G659187 / 5MG
Add to Inquiry
GPR84 antagonist 1

GPR84 antagonist 1

AL-G659187 / 10MG
Add to Inquiry
GB-110 hydrochloride

GB-110 hydrochloride

AL-G659189 / 10MG
Add to Inquiry
GB-110 hydrochloride

GB-110 hydrochloride

AL-G659189 / 25MG
Add to Inquiry
GB-110 hydrochloride

GB-110 hydrochloride

AL-G659189 / 100MG
Add to Inquiry
GB-110 hydrochloride

GB-110 hydrochloride

AL-G659189 / 50MG
Add to Inquiry
GB-110 hydrochloride

GB-110 hydrochloride

AL-G659189 / 5MG
Add to Inquiry
G3-C12 TFA

G3-C12 TFA

AL-G659199 / 10MG
Add to Inquiry
G3-C12 TFA

G3-C12 TFA

AL-G659199 / 1MG
Add to Inquiry
G3-C12 TFA

G3-C12 TFA

AL-G659199 / 5MG
Add to Inquiry
Ganaplacide hydrochloride

Ganaplacide hydrochloride

AL-G659214 / 5MG
Add to Inquiry
Ganaplacide hydrochloride

Ganaplacide hydrochloride

AL-G659214 / 50MG
Add to Inquiry
Ganaplacide hydrochloride

Ganaplacide hydrochloride

AL-G659214 / 10MG
Add to Inquiry
GSK-J1 lithium salt

GSK-J1 lithium salt

AL-G659223 / 100MG
Add to Inquiry
GSK-J1 lithium salt

GSK-J1 lithium salt

AL-G659223 / 10MG
Add to Inquiry
GSK-J1 lithium salt

GSK-J1 lithium salt

AL-G659223 / 50MG
Add to Inquiry
GSK-J1 lithium salt

GSK-J1 lithium salt

AL-G659223 / 25MG
Add to Inquiry
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Add to Inquiry
LOCATIONS

Service location

Taipei, New Taipei, Keelung / Yilan / Hualien
Inquiry Cart

Your inquiry Cart total 0 items

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
Manage Cookies

Privacy Preference Center

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
View Privacy Policy

Manage Consent Settings

Necessary Cookies

Enable all
The operation of the website relies on these cookies, and you cannot disable them in the system. These cookies are usually set based on the actions you take (i.e., service requests), such as setting privacy preferences, logging in, or filling out forms. You can set your browser to block or prompt you about these cookies, but this may cause some website functions to stop working.