TW
Inquiry Cart

Chemical materials

Amodiaquine 98%

Amodiaquine 98%

A911533 / 250MG
CAS No.：86-42-0
Add to Inquiry
Amodiaquine 98%

Amodiaquine 98%

A911533 / 100MG
CAS No.：86-42-0
Add to Inquiry
Amodiaquine 98%

Amodiaquine 98%

A911533 / 25MG
CAS No.：86-42-0
Add to Inquiry
Amodiaquine 98%

Amodiaquine 98%

A911533 / 5MG
CAS No.：86-42-0
Add to Inquiry
Auxinole 98%

Auxinole 98%

A911541 / 25MG
CAS No.：86445-22-9
Add to Inquiry
Auxinole 98%

Auxinole 98%

A911541 / 100MG
CAS No.：86445-22-9
Add to Inquiry
Auxinole 98%

Auxinole 98%

A911541 / 5MG
CAS No.：86445-22-9
Add to Inquiry
AMG 837 sodium salt 98%

AMG 837 sodium salt 98%

A911545 / 5MG
CAS No.：865231-45-4
Add to Inquiry
A-770041 98%

A-770041 98%

A911559 / 5MG
CAS No.：869748-10-7
Add to Inquiry
A-770041 98%

A-770041 98%

A911559 / 25MG
CAS No.：869748-10-7
Add to Inquiry
A-841720 98%

A-841720 98%

A911560 / 1MG
CAS No.：869802-58-4
Add to Inquiry
A 839977 98%

A 839977 98%

A911562 / 25MG
CAS No.：870061-27-1
Add to Inquiry
A 839977 98%

A 839977 98%

A911562 / 10MG
CAS No.：870061-27-1
Add to Inquiry
A 839977 98%

A 839977 98%

A911562 / 100MG
CAS No.：870061-27-1
Add to Inquiry
A 839977 98%

A 839977 98%

A911562 / 250MG
CAS No.：870061-27-1
Add to Inquiry
ACH-806 (GS9132) 98%

ACH-806 (GS9132) 98%

A911563 / 1MG
CAS No.：870142-71-5
Add to Inquiry
Almorexant (ACT 078573) 98%

Almorexant (ACT 078573) 98%

A911569 / 5MG
CAS No.：871224-64-5
Add to Inquiry
Almorexant (ACT 078573) 98%

Almorexant (ACT 078573) 98%

A911569 / 1MG
CAS No.：871224-64-5
Add to Inquiry
trans-AUCB 98%

trans-AUCB 98%

A911586 / 5MG
CAS No.：885012-33-9
Add to Inquiry
Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

A911590 / 25MG
CAS No.：88898-17-3
Add to Inquiry
Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

A911590 / 5MG
CAS No.：88898-17-3
Add to Inquiry
Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

Atrial Natriuretic Peptide (ANP) (1-28)， rat (Atrial natriuretic factor(1-28)(rat)) 98%

A911590 / 1MG
CAS No.：88898-17-3
Add to Inquiry
APNEA (N6- 98%

APNEA (N6- 98%

A911594 / 10MG
CAS No.：89705-21-5
Add to Inquiry
Antineoplaston A10 98%

Antineoplaston A10 98%

A911606 / 25MG
CAS No.：91531-30-5
Add to Inquiry
Antineoplaston A10 98%

Antineoplaston A10 98%

A911606 / 5MG
CAS No.：91531-30-5
Add to Inquiry
AZ-23 98%

AZ-23 98%

A911609 / 5MG
CAS No.：915720-21-7
Add to Inquiry
APTO-253 ≥98%

APTO-253 ≥98%

A911612 / 100MG
CAS No.：916151-99-0
Add to Inquiry
APTO-253 ≥98%

APTO-253 ≥98%

A911612 / 1MG
CAS No.：916151-99-0
Add to Inquiry
APTO-253 ≥98%

APTO-253 ≥98%

A911612 / 5MG
CAS No.：916151-99-0
Add to Inquiry
APTO-253 ≥98%

APTO-253 ≥98%

A911612 / 25MG
CAS No.：916151-99-0
Add to Inquiry
Avoralstat (BCX4161) 98%

Avoralstat (BCX4161) 98%

A911619 / 5MG
CAS No.：918407-35-9
Add to Inquiry
Avoralstat (BCX4161) 98%

Avoralstat (BCX4161) 98%

A911619 / 50MG
CAS No.：918407-35-9
Add to Inquiry
A7132 98%

A7132 98%

A911669 / 1MG
CAS No.：100490-21-9
Add to Inquiry
A7132 98%

A7132 98%

A911669 / 5MG
CAS No.：100490-21-9
Add to Inquiry
AMG-009 98%

AMG-009 98%

A911675 / 1MG
CAS No.：1027847-67-1
Add to Inquiry
ABL127 98%

ABL127 98%

A911680 / 5MG
CAS No.：1073529-41-5
Add to Inquiry
Amrubicin (AMR) ≥98%

Amrubicin (AMR) ≥98%

A911685 / 1MG
CAS No.：110267-81-7
Add to Inquiry
Alvameline (Lu 25-109) 98%

Alvameline (Lu 25-109) 98%

A911706 / 1MG
CAS No.：120241-31-8
Add to Inquiry
Amibegron hydrochloride (SR 58611A) 98%

Amibegron hydrochloride (SR 58611A) 98%

A911708 / 5MG
CAS No.：121524-09-2
Add to Inquiry
ABT-639 hydrochloride 98%

ABT-639 hydrochloride 98%

A911714 / 1MG
CAS No.：1235560-31-2
Add to Inquiry
ABT-639 hydrochloride 98%

ABT-639 hydrochloride 98%

A911714 / 5MG
CAS No.：1235560-31-2
Add to Inquiry
Alvimopan monohydrate 98%

Alvimopan monohydrate 98%

A911736 / 1MG
CAS No.：1383577-62-5
Add to Inquiry
ATPA 98%

ATPA 98%

A911739 / 5MG
CAS No.：140158-50-5
Add to Inquiry
A-83016F (Antibiotic A-83016F) 98%

A-83016F (Antibiotic A-83016F) 98%

A911748 / 500ΜG
CAS No.：142435-72-1
Add to Inquiry
AM2233 azepane isomer 98%

AM2233 azepane isomer 98%

A911760 / 1MG
CAS No.：1432478-91-5
Add to Inquiry
Agistatin B 98%

Agistatin B 98%

A911767 / 1MG
CAS No.：144096-46-8
Add to Inquiry
Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV) 98%

Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV) 98%

A911770 / 1MG
CAS No.：144409-98-3
Add to Inquiry
Allopurinol riboside 98%

Allopurinol riboside 98%

A911795 / 25MG
CAS No.：16220-07-8
Add to Inquiry
Allopurinol riboside 98%

Allopurinol riboside 98%

A911795 / 5MG
CAS No.：16220-07-8
Add to Inquiry
ABC34 98%

ABC34 98%

A911839 / 1MG
CAS No.：1831135-56-8
Add to Inquiry
LOCATIONS

Service location

Taipei, New Taipei, Keelung / Yilan / Hualien
  • Taipei, New Taipei, Keelung / Yilan / Hualien
  • Taoyuan
  • Hsinchu County / Hsinchu City / Miaoli
  • Taichung/Changhua/Nantou
  • Yunlin/Chiayi/Tainan
  • Kaohsiung/Pingtung/Taitung

Taipei Branch

Address 5th Floor, No. 10, Lane 50, Section 3, Nangang Road, Nangang District, Taipei City
Telephone 02-2786-2331
Fax 02-2653-6959
Mail taipei@echochemical.com

Taoyuan Branch

Address 2nd Floor, No. 62, Fuxing Street, Pingzhen District, Taoyuan City
Telephone 03-494-6939
Fax 03-493-0687
Mail chungli@echochemical.com

Head Office / Zhumen Branch

Address No. 16, Gongye Road, Toufen City, Miaoli County
Telephone 037-621-088
Fax 037-615-096
Mail miaoli@echochemical.com

Taichung Branch

Address 15F-2, No. 218, Section 1, Wenxin Road, Nantun District, Taichung City
Telephone 04-2472-8859
Fax 04-2472-8825
Mail taichung@echochemical.com

Tainan Branch

Address No. 33, Lane 63, Yanzhou 1st Street, Yongkang District, Tainan City
Telephone 06-243-6589
Fax 06-253-8208
Mail tainan@echochemical.com

Kaohsiung Branch

Address No. 479, Fengding Road, Fengshan District, Kaohsiung City
Telephone 07-753-9988
Fax 07-753-1958
Mail kaohsiung@echochemical.com
北北基/宜蘭/花蓮 桃園 新竹縣/新竹市/苗栗 台中/彰化/南投 雲林/嘉義/台南 高雄/屏東/台東
mapNorth
mapTaoyuan
mapHsinchu
mapCentral
mapYunlin
mapSouth
TW
Inquiry Cart
Inquiry Cart

Your inquiry Cart total 0 items

Inquiry Form
In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
Manage Cookies

Privacy Preference Center

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
View Privacy Policy

Manage Consent Settings

Necessary Cookies

Enable all
The operation of the website relies on these cookies, and you cannot disable them in the system. These cookies are usually set based on the actions you take (i.e., service requests), such as setting privacy preferences, logging in, or filling out forms. You can set your browser to block or prompt you about these cookies, but this may cause some website functions to stop working.