TW
Inquiry Cart

Chemical materials

Ac-VEID-AMC 98%

Ac-VEID-AMC 98%

A912199 / 1MG
CAS No.：219137-97-0
Add to Inquiry
Ac-IETD-pNA 98%

Ac-IETD-pNA 98%

A912200 / 1MG
CAS No.：219138-21-3
Add to Inquiry
Aspochracin 98%

Aspochracin 98%

A912206 / 500ΜG
CAS No.：22029-09-0
Add to Inquiry
A-437203 98%

A-437203 98%

A912207 / 1MG
CAS No.：220519-06-2
Add to Inquiry
Arachidonoyl 2'-Chloroethylamide 98%

Arachidonoyl 2'-Chloroethylamide 98%

A912208 / 50MG
CAS No.：220556-69-4
Add to Inquiry
Arachidonoyl 2'-Chloroethylamide 98%

Arachidonoyl 2'-Chloroethylamide 98%

A912208 / 25MG
CAS No.：220556-69-4
Add to Inquiry
Arachidonoyl 2'-Chloroethylamide 98%

Arachidonoyl 2'-Chloroethylamide 98%

A912208 / 5MG
CAS No.：220556-69-4
Add to Inquiry
Aminopurvalanol A (NG 97) 98%

Aminopurvalanol A (NG 97) 98%

A912210 / 25MG
CAS No.：220792-57-4
Add to Inquiry
Aminopurvalanol A (NG 97) 98%

Aminopurvalanol A (NG 97) 98%

A912210 / 5MG
CAS No.：220792-57-4
Add to Inquiry
Atorvastatin-d5 calcium salt 98%

Atorvastatin-d5 calcium salt 98%

A912223 / 500ΜG
CAS No.：222412-82-0
Add to Inquiry
2-Arachidonyl Glycerol ether 98%，10 mg/mL in ethanol (1% w/v)

2-Arachidonyl Glycerol ether 98%，10 mg/mL in ethanol (1% w/v)

A912225 / 5MG
CAS No.：222723-55-9
Add to Inquiry
Arachidonoyl Cyclopropylamide (ACPA) 98%

Arachidonoyl Cyclopropylamide (ACPA) 98%

A912256 / 5MG
CAS No.：229021-64-1
Add to Inquiry
ddATP (2'，3'-Dideoxyadenosine 5'-triphosphate) 98%，10 mM in H2O

ddATP (2'，3'-Dideoxyadenosine 5'-triphosphate) 98%，10 mM in H2O

A912300 / 100ΜL
CAS No.：24027-80-3
Add to Inquiry
AL 8810 98%

AL 8810 98%

A912333 / 1MG
CAS No.：246246-19-5
Add to Inquiry
Aeroplysinin 1 ((+)-Aeroplysinin-1) 98%

Aeroplysinin 1 ((+)-Aeroplysinin-1) 98%

A912350 / 100ΜG
CAS No.：28656-91-9
Add to Inquiry
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

A912358 / 1MG
CAS No.：317366-82-8
Add to Inquiry
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

A912358 / 5MG
CAS No.：317366-82-8
Add to Inquiry
ortho-fluoro 4-ANBP ≥98%

ortho-fluoro 4-ANBP ≥98%

A912381 / 5MG
CAS No.：416876-71-6
Add to Inquiry
Alloepipregnanolone 98%

Alloepipregnanolone 98%

A912403 / 1G
CAS No.：516-55-2
Add to Inquiry
Alloepipregnanolone 98%

Alloepipregnanolone 98%

A912403 / 50MG
CAS No.：516-55-2
Add to Inquiry
Alloepipregnanolone 98%

Alloepipregnanolone 98%

A912403 / 250MG
CAS No.：516-55-2
Add to Inquiry
AP-18 98%

AP-18 98%

A912516 / 5MG
CAS No.：55224-94-7
Add to Inquiry
Alamethicin F50 (18-L-Glutamine Alamethicin I) 98%

Alamethicin F50 (18-L-Glutamine Alamethicin I) 98%

A912537 / 1MG
CAS No.：56165-93-6
Add to Inquiry
Altertoxin I (Dihydroalterperylenol) 98%

Altertoxin I (Dihydroalterperylenol) 98%

A912539 / 1MG
CAS No.：56258-32-3
Add to Inquiry
Altertoxin I (Dihydroalterperylenol) 98%

Altertoxin I (Dihydroalterperylenol) 98%

A912539 / 100ΜG
CAS No.：56258-32-3
Add to Inquiry
Acetophenazine dimaleate 98%

Acetophenazine dimaleate 98%

A912564 / 25MG
CAS No.：5714-00-1
Add to Inquiry
Acetophenazine dimaleate 98%

Acetophenazine dimaleate 98%

A912564 / 100MG
CAS No.：5714-00-1
Add to Inquiry
Acetophenazine dimaleate 98%

Acetophenazine dimaleate 98%

A912564 / 500MG
CAS No.：5714-00-1
Add to Inquiry
Acetophenazine dimaleate 98%

Acetophenazine dimaleate 98%

A912564 / 1G
CAS No.：5714-00-1
Add to Inquiry
Asterric Acid 98%

Asterric Acid 98%

A912575 / 1MG
CAS No.：577-64-0
Add to Inquiry
5，6-dehydro Arachidonic Acid (5，6-dehydro AA) 98%

5，6-dehydro Arachidonic Acid (5，6-dehydro AA) 98%

A912598 / 50ΜG
CAS No.：58688-54-3
Add to Inquiry
Actagardin 98%

Actagardin 98%

A912608 / 1MG
CAS No.：59165-34-3
Add to Inquiry
Aminopeptidase N Inhibitor (AP-N Inhibitor) 98%

Aminopeptidase N Inhibitor (AP-N Inhibitor) 98%

A912619 / 1MG
CAS No.：596108-59-7
Add to Inquiry
Anhydroophiobolin A 98%

Anhydroophiobolin A 98%

A912642 / 1MG
CAS No.：6026-65-9
Add to Inquiry
Antheraxanthin 95%

Antheraxanthin 95%

A912668 / 1MG
CAS No.：640-03-9
Add to Inquiry
7-Aminoactinomycin D (7-AAD) 98%

7-Aminoactinomycin D (7-AAD) 98%

A912679 / 5MG
CAS No.：7240-37-1
Add to Inquiry
7-Aminoactinomycin D (7-AAD) 98%

7-Aminoactinomycin D (7-AAD) 98%

A912679 / 1MG
CAS No.：7240-37-1
Add to Inquiry
Amorfrutin A (Amorfrutin 1) 98%

Amorfrutin A (Amorfrutin 1) 98%

A912707 / 500ΜG
CAS No.：80489-90-3
Add to Inquiry
AH 23848 (calcium salt) 98%

AH 23848 (calcium salt) 98%

A912724 / 1MG
CAS No.：81496-19-7
Add to Inquiry
Aszonalenin (NSC 374337) 98%

Aszonalenin (NSC 374337) 98%

A912733 / 1MG
CAS No.：81797-27-5
Add to Inquiry
AUY954 98%

AUY954 98%

A912743 / 1MG
CAS No.：820240-77-5
Add to Inquiry
Ansatrienin A (Mycotrienin I) 98%

Ansatrienin A (Mycotrienin I) 98%

A912744 / 1MG
CAS No.：82189-03-5
Add to Inquiry
Ansatrienin B 98%

Ansatrienin B 98%

A912745 / 1MG
CAS No.：82189-04-6
Add to Inquiry
Abz-Ala-Pro-Glu-Glu-Ile-Met-Arg-Arg-Gln-EDDnp 98%

Abz-Ala-Pro-Glu-Glu-Ile-Met-Arg-Arg-Gln-EDDnp 98%

A912753 / 1MG
CAS No.：824405-61-0
Add to Inquiry
Atomoxetine 98%

Atomoxetine 98%

A912776 / 50MG
CAS No.：83015-26-3
Add to Inquiry
Atomoxetine 98%

Atomoxetine 98%

A912776 / 5MG
CAS No.：83015-26-3
Add to Inquiry
Atomoxetine 98%

Atomoxetine 98%

A912776 / 10MG
CAS No.：83015-26-3
Add to Inquiry
Acetildenafil (Hongdenafil) 98%

Acetildenafil (Hongdenafil) 98%

A912780 / 5MG
CAS No.：831217-01-7
Add to Inquiry
Anipamil 98%

Anipamil 98%

A912783 / 1MG
CAS No.：83200-10-6
Add to Inquiry
6-Aminophenanthridine (6AP) 98%

6-Aminophenanthridine (6AP) 98%

A912785 / 5MG
CAS No.：832-68-8
Add to Inquiry
LOCATIONS

Service location

Taipei, New Taipei, Keelung / Yilan / Hualien
  • Taipei, New Taipei, Keelung / Yilan / Hualien
  • Taoyuan
  • Hsinchu County / Hsinchu City / Miaoli
  • Taichung/Changhua/Nantou
  • Yunlin/Chiayi/Tainan
  • Kaohsiung/Pingtung/Taitung

Taipei Branch

Address 5th Floor, No. 10, Lane 50, Section 3, Nangang Road, Nangang District, Taipei City
Telephone 02-2786-2331
Fax 02-2653-6959
Mail taipei@echochemical.com

Taoyuan Branch

Address 2nd Floor, No. 62, Fuxing Street, Pingzhen District, Taoyuan City
Telephone 03-494-6939
Fax 03-493-0687
Mail chungli@echochemical.com

Head Office / Zhumen Branch

Address No. 16, Gongye Road, Toufen City, Miaoli County
Telephone 037-621-088
Fax 037-615-096
Mail miaoli@echochemical.com

Taichung Branch

Address 15F-2, No. 218, Section 1, Wenxin Road, Nantun District, Taichung City
Telephone 04-2472-8859
Fax 04-2472-8825
Mail taichung@echochemical.com

Tainan Branch

Address No. 33, Lane 63, Yanzhou 1st Street, Yongkang District, Tainan City
Telephone 06-243-6589
Fax 06-253-8208
Mail tainan@echochemical.com

Kaohsiung Branch

Address No. 479, Fengding Road, Fengshan District, Kaohsiung City
Telephone 07-753-9988
Fax 07-753-1958
Mail kaohsiung@echochemical.com
北北基/宜蘭/花蓮 桃園 新竹縣/新竹市/苗栗 台中/彰化/南投 雲林/嘉義/台南 高雄/屏東/台東
mapNorth
mapTaoyuan
mapHsinchu
mapCentral
mapYunlin
mapSouth
TW
Inquiry Cart
Inquiry Cart

Your inquiry Cart total 0 items

Inquiry Form
In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
Manage Cookies

Privacy Preference Center

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
View Privacy Policy

Manage Consent Settings

Necessary Cookies

Enable all
The operation of the website relies on these cookies, and you cannot disable them in the system. These cookies are usually set based on the actions you take (i.e., service requests), such as setting privacy preferences, logging in, or filling out forms. You can set your browser to block or prompt you about these cookies, but this may cause some website functions to stop working.