Chemical materials

FT3967385 ≥99%

FT3967385 ≥99%

F658816-10MG / 10MG
Add to Inquiry
FT3967385 ≥99%

FT3967385 ≥99%

F658816-5MG / 5MG
Add to Inquiry
Fmoc-Ala-Glu-Gln-Lys-NH2 ≥99%
Add to Inquiry
Fmoc-Ala-Glu-Gln-Lys-NH2 ≥99%
Add to Inquiry
3X FLAG peptide TFA ≥99%

3X FLAG peptide TFA ≥99%

F658858-10MG / 10MG
Add to Inquiry
3X FLAG peptide TFA ≥99%

3X FLAG peptide TFA ≥99%

F658858-1MG / 1MG
Add to Inquiry
3X FLAG peptide TFA ≥99%

3X FLAG peptide TFA ≥99%

F658858-25MG / 25MG
Add to Inquiry
3X FLAG peptide TFA ≥99%

3X FLAG peptide TFA ≥99%

F658858-5MG / 5MG
Add to Inquiry
Firsocostat (S enantiomer) ≥98%
Add to Inquiry
FC131 TFA ≥98%

FC131 TFA ≥98%

F658875-10MG / 10MG
Add to Inquiry
FC131 TFA ≥98%

FC131 TFA ≥98%

F658875-1MG / 1MG
Add to Inquiry
FC131 TFA ≥98%

FC131 TFA ≥98%

F658875-5MG / 5MG
Add to Inquiry
FITC-labeled Tominersen ≥95%

FITC-labeled Tominersen ≥95%

F658916-1MG / 1MG
Add to Inquiry
FITC-labeled Tominersen ≥95%

FITC-labeled Tominersen ≥95%

F658916-5MG / 5MG
Add to Inquiry
Fmoc-Glu-(Boc)-Val-Cit-PAB-PNP ≥98%
Add to Inquiry
Fmoc-Glu-(Boc)-Val-Cit-PAB-PNP ≥98%
Add to Inquiry
Fmoc-Glu-(Boc)-Val-Cit-PAB-PNP ≥98%
Add to Inquiry
Fluorescein-NAD+ ≥66%

Fluorescein-NAD+ ≥66%

F658989-81ΜG / 81ΜG
Add to Inquiry
Fluvastatin-D₆ sodium Moligand™, ≥98 atom% D,≥96%
Add to Inquiry
Formononetin-d3-1 ≥99%

Formononetin-d3-1 ≥99%

F659153-1MG / 1MG
Add to Inquiry
Formononetin-d3-1 ≥99%

Formononetin-d3-1 ≥99%

F659153-5MG / 5MG
Add to Inquiry
Fz7-21 TFA ≥99%

Fz7-21 TFA ≥99%

F659200-10MG / 10MG
Add to Inquiry
Fz7-21 TFA ≥99%

Fz7-21 TFA ≥99%

F659200-50MG / 50MG
Add to Inquiry
Fz7-21 TFA ≥99%

Fz7-21 TFA ≥99%

F659200-5MG / 5MG
Add to Inquiry
FTI-2153 TFA ≥98%

FTI-2153 TFA ≥98%

F659224-100MG / 100MG
Add to Inquiry
FTI-2153 TFA ≥98%

FTI-2153 TFA ≥98%

F659224-10MG / 10MG
Add to Inquiry
FTI-2153 TFA ≥98%

FTI-2153 TFA ≥98%

F659224-25MG / 25MG
Add to Inquiry
FTI-2153 TFA ≥98%

FTI-2153 TFA ≥98%

F659224-50MG / 50MG
Add to Inquiry
FTI-2153 TFA ≥98%

FTI-2153 TFA ≥98%

F659224-5MG / 5MG
Add to Inquiry
FABPs ligand 6 ≥98%

FABPs ligand 6 ≥98%

F659237-10MG / 10MG
Add to Inquiry
FABPs ligand 6 ≥98%

FABPs ligand 6 ≥98%

F659237-25MG / 25MG
Add to Inquiry
FABPs ligand 6 ≥98%

FABPs ligand 6 ≥98%

F659237-5MG / 5MG
Add to Inquiry
Fludarabine triphosphate trisodium ≥95%

Fludarabine triphosphate trisodium ≥95%

F659287-10MG / 10MG
CAS No.:74832-57-8
Add to Inquiry
Fludarabine triphosphate trisodium ≥95%

Fludarabine triphosphate trisodium ≥95%

F659287-1MG / 1MG
CAS No.:74832-57-8
Add to Inquiry
Fludarabine triphosphate trisodium ≥95%

Fludarabine triphosphate trisodium ≥95%

F659287-25MG / 25MG
CAS No.:74832-57-8
Add to Inquiry
Fludarabine triphosphate trisodium ≥95%

Fludarabine triphosphate trisodium ≥95%

F659287-5MG / 5MG
CAS No.:74832-57-8
Add to Inquiry
Fradafiban hydrochloride ≥99%
Add to Inquiry
Flagelin 22 TFA ≥97%

Flagelin 22 TFA ≥97%

F659335-10MG / 10MG
Add to Inquiry
Flagelin 22 TFA ≥97%

Flagelin 22 TFA ≥97%

F659335-1MG / 1MG
Add to Inquiry
Flagelin 22 TFA ≥97%

Flagelin 22 TFA ≥97%

F659335-5MG / 5MG
Add to Inquiry
Fenpropathrin-d5 ≥98%

Fenpropathrin-d5 ≥98%

F659339-10MG / 10MG
Add to Inquiry
Fenpropathrin-d5 ≥98%

Fenpropathrin-d5 ≥98%

F659339-1MG / 1MG
Add to Inquiry
Fenpropathrin-d5 ≥98%

Fenpropathrin-d5 ≥98%

F659339-5MG / 5MG
Add to Inquiry
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ≥98%
Add to Inquiry
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ≥98%
Add to Inquiry
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ≥98%
Add to Inquiry
FTISADTSK acetate ≥99%

FTISADTSK acetate ≥99%

F659412-10MG / 10MG
CAS No.:1431957-73-1
Add to Inquiry
FTISADTSK acetate ≥99%

FTISADTSK acetate ≥99%

F659412-1MG / 1MG
CAS No.:1431957-73-1
Add to Inquiry
FTISADTSK acetate ≥99%

FTISADTSK acetate ≥99%

F659412-25MG / 25MG
CAS No.:1431957-73-1
Add to Inquiry
FTISADTSK acetate ≥99%

FTISADTSK acetate ≥99%

F659412-5MG / 5MG
CAS No.:1431957-73-1
Add to Inquiry
LOCATIONS

Service location

Taipei, New Taipei, Keelung / Yilan / Hualien
Inquiry Cart

Your inquiry Cart total 0 items

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
Manage Cookies

Privacy Preference Center

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
View Privacy Policy

Manage Consent Settings

Necessary Cookies

Enable all
The operation of the website relies on these cookies, and you cannot disable them in the system. These cookies are usually set based on the actions you take (i.e., service requests), such as setting privacy preferences, logging in, or filling out forms. You can set your browser to block or prompt you about these cookies, but this may cause some website functions to stop working.