Chemical materials
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%

Manufacturer: MACKLIN
Item Number: A912358
Product Name: Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96%
Specifications: 1MG
CAS No.: 317366-82-8
Catalog No.: A912358
Notice: Part of item is only available for pre-order. If you have procurement needs, please contact us for inquiries.
Share:
Add to Inquiry
LOCATIONS

Service location

Taipei, New Taipei, Keelung / Yilan / Hualien
Inquiry Cart

Your inquiry Cart total 0 items

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
Manage Cookies

Privacy Preference Center

In accordance with the EU General Data Protection Regulation, we are committed to protecting your personal data and providing you with control over your personal data.
By clicking "Accept All," you allow us to place cookies to enhance your experience on this website, help us analyze website performance and usage, and enable us to deliver relevant marketing content. You can manage your cookie settings below. Clicking "Confirm" means you agree to the current settings.
View Privacy Policy

Manage Consent Settings

Necessary Cookies

Enable all
The operation of the website relies on these cookies, and you cannot disable them in the system. These cookies are usually set based on the actions you take (i.e., service requests), such as setting privacy preferences, logging in, or filling out forms. You can set your browser to block or prompt you about these cookies, but this may cause some website functions to stop working.